Results | PROST

Summary

Q8TEV8

Homolog: Q9BE57.
Function: Smith-Magenis syndrome chromosomal region candidate gene 5 protein homolog.

Statistics

Total GO Annotation: 6
Unique PROST Go: 6
Unique BLAST Go: 0

Total Homologs: 25
Unique PROST Homologs: 23
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q9BE57 (Smith-Magenis syndrome chromosomal region candidate gene 5 protein homolog) with a FATCAT P-Value: 0.00701 and RMSD of 3.09 angstrom. The sequence alignment identity is 86.8%.
Structural alignment shown in left. Query protein Q8TEV8 colored as red in alignment, homolog Q9BE57 colored as blue. Query protein Q8TEV8 is also shown in right top, homolog Q9BE57 showed in right bottom. They are colored based on secondary structures.

  Q8TEV8 MRRCLRVKTRRGQLGLASSCFEQHSCFSPRVNRILSAVQNTLCTGPSSQAPPQPPQASPPAAADHSRTPSLLASSHSASGGESLFQLYIASLAWPQNCCV 100
  Q9BE57 MRRCLRVKTRRGQLGLASGCFEQHSCFSPRVNRILSAVQNTPCAGPSSQAPPQPPQASPPAAPDHSRTPSLLASSHSASGGESLFQLYMASLAWPQNCCV 100

  Q8TEV8 LESCRRIPLGGLSSMENRRPLLRKGRLLRGQIHHSQTNEL------------ 140
  Q9BE57 LESCRRIPLGGLSSMENRRPLLRKGRLLRGQIHHGQDNQLWGLTGAGALLSG 152

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Show entries

Search:

Source	GO	Description
2. P	GO:0007266	Rho protein signal transduction
2. P	GO:0031267	small GTPase binding
2. P	GO:0030838	positive regulation of actin filament polymerization
2. P	GO:0012505	endomembrane system
2. P	GO:0031274	positive regulation of pseudopodium assembly
2. P	GO:0007254	JNK cascade

Showing 1 to 6 of 6 entries

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Show entries

Search:

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	Q8TEV8	Smith-Magenis syndrome chromosomal region candidate gene 5 protein	0	5.69e-147	7.78e-98
1. PB	Q9BE57	Smith-Magenis syndrome chromosomal region candidate gene 5 protein homolog	7.01e-03	1.17e-46	1.34e-69
2. P	Q6XXX2	Putative uncharacterized protein encoded by LINC00114	2.60e-01	1.22e-02	NA
2. P	Q8TGM9	Putative uncharacterized protein YKR075W-A	1.19e-01	1.09e-02	NA
2. P	P53087	Putative uncharacterized protein YGL214W	2.51e-01	1.61e-03	NA
2. P	Q2M3A8	Putative uncharacterized protein MRGPRG-AS1	1.11e-01	2.43e-02	NA
2. P	Q8N9T2	Putative uncharacterized protein CXorf42	2.85e-01	2.80e-05	NA
2. P	P59023	Down syndrome critical region protein 10	5.81e-01	1.26e-04	NA
2. P	Q8N2B8	Putative uncharacterized protein FLJ33534	4.38e-01	1.59e-04	NA
2. P	Q5TC04	Putative uncharacterized protein ATP1A1-AS1	2.12e-01	7.70e-05	NA

Showing 1 to 10 of 25 entries