Summary

Q69383

Homolog: P61572.
Function: Endogenous retrovirus group K member 19 Rec protein.

Statistics

Total GO Annotation: 24
Unique PROST Go: 8
Unique BLAST Go: 10

Total Homologs: 24
Unique PROST Homologs: 6
Unique BLAST Homologs: 9

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was P61572 (Endogenous retrovirus group K member 19 Rec protein) with a FATCAT P-Value: 2.42e-14 and RMSD of 2.51 angstrom. The sequence alignment identity is 100.0%.
Structural alignment shown in left. Query protein Q69383 colored as red in alignment, homolog P61572 colored as blue. Query protein Q69383 is also shown in right top, homolog P61572 showed in right bottom. They are colored based on secondary structures. 

  Q69383 MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETAT 100
  P61572 MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETAT 100

  Q69383 IENGP 105
  P61572 IENGP 105

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.