Results | PROST

Summary

P0DMW5

Homolog: Q96HG1.
Function: Small integral membrane protein 10.

Statistics

Total GO Annotation: 15
Unique PROST Go: 15
Unique BLAST Go: 0

Total Homologs: 19
Unique PROST Homologs: 15
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PB was Q96HG1 (Small integral membrane protein 10) with a FATCAT P-Value: 1.81e-10 and RMSD of 0.95 angstrom. The sequence alignment identity is 69.0%.
Structural alignment shown in left. Query protein P0DMW5 colored as red in alignment, homolog Q96HG1 colored as blue. Query protein P0DMW5 is also shown in right top, homolog Q96HG1 showed in right bottom. They are colored based on secondary structures.

  P0DMW5 MAA--SAA-LSA---AAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPYFYIVASVMLNVRLQVRIE 78
  Q96HG1 MEALGSGHYVGGSIRSMAAAALSGLAVRLSRPQGTRGSYGAFCKTLTRTLLTFFDLAWRLRKNFFYFYILASVILNVHLQVYI- 83

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Show entries

Search:

Source	GO	Description
2. P	GO:1990414	replication-born double-strand break repair via sister chromatid exchange
2. P	GO:0019054	modulation by virus of host cellular process
2. P	GO:0039635	suppression by virus of host peptidoglycan biosynthetic process
2. P	GO:0044659	viral release from host cell by cytolysis
2. P	GO:0039640	viral release by cytolysis via suppression of host peptidoglycan biosynthetic process
2. P	GO:0019835	cytolysis
2. P	GO:0006312	mitotic recombination
2. P	GO:0005739	mitochondrion
2. P	GO:0005741	mitochondrial outer membrane
2. P	GO:0008009	chemokine activity

Showing 1 to 10 of 15 entries

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Show entries

Search:

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	P0DMW4	Small integral membrane protein 10-like protein 2A	4.06e-09	4.02e-136	1.73e-48
1. PB	P0DMW3	Small integral membrane protein 10-like protein 1	1.13e-05	2.65e-09	1.56e-24
1. PB	Q96HG1	Small integral membrane protein 10	1.81e-10	1.11e-08	5.37e-32
1. PB	P0DMW5	Small integral membrane protein 10-like protein 2B	0	4.02e-136	1.73e-48
2. P	A1L4Q6	Putative uncharacterized protein FLJ41423	1.00e-01	5.23e-03	NA
2. P	P34249	Uncharacterized protein YKL102C	4.49e-01	9.35e-05	NA
2. P	Q3E7A3	Uncharacterized protein YJL133C-A	3.76e-04	2.88e-06	NA
2. P	P19778	Insertion element IS2 uncharacterized 11.1 kDa protein	3.37e-03	5.15e-04	NA
2. P	P47010	Putative uncharacterized protein IRC9	2.68e-05	1.47e-03	NA
2. P	P52461	Putative CC-type chemokine U83	NA	9.21e-03	NA

Showing 1 to 10 of 19 entries