Results | PROST

Summary

E9PRG8

Homolog: Q9BKU8.
Function: Modifier of protein aggregation 4.

Statistics

Total GO Annotation: 23
Unique PROST Go: 23
Unique BLAST Go: 0

Total Homologs: 36
Unique PROST Homologs: 34
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was Q9BKU8 (Modifier of protein aggregation 4) with a FATCAT P-Value: 0.00336 and RMSD of 1.78 angstrom. The sequence alignment identity is 20.8%.
Structural alignment shown in left. Query protein E9PRG8 colored as red in alignment, homolog Q9BKU8 colored as blue. Query protein E9PRG8 is also shown in right top, homolog Q9BKU8 showed in right bottom. They are colored based on secondary structures.

  E9PRG8 MGAPGGKINRPRTELKKKLFKR--RRVLNRERRLRHRVVGAVIDQGLITRHHLKKR--AS--SARANITLSGKKRRKLLQQIRLAQKEKTAMEVEAPSKP 94
  Q9BKU8 -------------------MTRGNQRDLAREKNQK-----KLADQ--------KKRQGASGQDGNAGLSMDARMNRD-ADVMRIKQ-EKAAAKKEAEAAA 66

  E9PRG8 ARTSEPQLKRQKKTKAPQD-VEMKDLEDES 123
  Q9BKU8 AAANA------KKV-AKVDPLKM------- 82

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Show entries

Search:

Source	GO	Description
2. P	GO:0019985	translesion synthesis
2. P	GO:0007566	embryo implantation
2. P	GO:0016586	RSC-type complex
2. P	GO:0045296	cadherin binding
2. P	GO:0042273	ribosomal large subunit biogenesis
2. P	GO:0005096	GTPase activator activity
2. P	GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
2. P	GO:0006337	nucleosome disassembly
2. P	GO:0016514	SWI/SNF complex
2. P	GO:0031011	Ino80 complex

Showing 1 to 10 of 23 entries

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Show entries

Search:

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	E9PRG8	Uncharacterized protein C11orf98	0	2.81e-129	1.65e-83
1. PB	Q9D937	Uncharacterized protein C11orf98 homolog	5.40e-09	1.15e-64	1.04e-59
2. P	Q9BKU8	Modifier of protein aggregation 4	3.36e-03	2.95e-02	NA
2. P	Q8HXB8	60S ribosomal protein L29	8.11e-02	3.57e-04	NA
2. P	Q0VG62	Ribosomal biogenesis factor	1.36e-01	1.84e-03	NA
2. P	B5FFA9	Der GTPase-activating protein YihI	1.24e-01	1.77e-04	NA
2. P	A5F4H7	Der GTPase-activating protein YihI	7.31e-02	3.46e-02	NA
2. P	Q9CQX4	PCNA-associated factor	4.49e-01	2.15e-02	NA
2. P	Q6LLQ8	Der GTPase-activating protein YihI	8.90e-02	2.09e-03	NA
2. P	Q6FL80	Ribosome biogenesis protein ALB1	2.84e-02	7.16e-05	NA

Showing 1 to 10 of 36 entries