Results | PROST

Summary

A6NGG3

Homolog: P14662.
Function: Bactericidin B-2.

Statistics

Total GO Annotation: 11
Unique PROST Go: 11
Unique BLAST Go: 0

Total Homologs: 17
Unique PROST Homologs: 16
Unique BLAST Homologs: 0

Structures and Sequence Alignment

The best structural homolog that predicted by 2. P was P14662 (Bactericidin B-2) with a FATCAT P-Value: 0.018 and RMSD of 3.21 angstrom. The sequence alignment identity is 16.5%.
Structural alignment shown in left. Query protein A6NGG3 colored as red in alignment, homolog P14662 colored as blue. Query protein A6NGG3 is also shown in right top, homolog P14662 showed in right bottom. They are colored based on secondary structures.

  A6NGG3 MARFQRTKEREEDRCSLNIYYVRNTTQGTAP--ACVGKRMQPSPTGKGGKCCTVHGLTRKIHNVQPNLQSPILSAACVD 77
  P14662 ---WNPFKELE--RAG---QRVRDAVISAAPAVATVG---QAAAIARG------------------------------- 37

Go Annotations

1. PB indicates the go terms that are found by both PROST and BLAST.
2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.

Show entries

Search:

Source	GO	Description
2. P	GO:0030435	sporulation resulting in formation of a cellular spore
2. P	GO:0070979	protein K11-linked ubiquitination
2. P	GO:0045664	regulation of neuron differentiation
2. P	GO:0017015	regulation of transforming growth factor beta receptor signaling pathway
2. P	GO:0019731	antibacterial humoral response
2. P	GO:0031103	axon regeneration
2. P	GO:0045087	innate immune response
2. P	GO:0005680	anaphase-promoting complex
2. P	GO:0030071	regulation of mitotic metaphase/anaphase transition
2. P	GO:0031145	anaphase-promoting complex-dependent catabolic process

Showing 1 to 10 of 11 entries

Homologs

1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.

Show entries

Search:

Source	Homolog	Description	FATCAT p-val	PROST Evalue	BLAST Evalue
1. PB	A6NGG3	Putative uncharacterized protein C9orf92	0	1.27e-147	2.04e-53
2. P	Q8TGK1	Uncharacterized protein YHR213W-B	4.90e-02	7.34e-03	NA
2. P	Q3E786	Uncharacterized protein YGR240C-A	5.55e-03	5.67e-04	NA
2. P	O83206	Uncharacterized protein TP_0176	2.18e-01	4.43e-02	NA
2. P	Q7WY63	Protein AntE	2.24e-02	5.31e-04	NA
2. P	Q8NFD4	Uncharacterized protein FLJ76381	1.35e-01	1.37e-02	NA
2. P	P14662	Bactericidin B-2	1.80e-02	3.69e-02	NA
2. P	P40536	Putative uncharacterized protein YIL032C	4.94e-02	2.03e-02	NA
2. P	Q5NVD3	Neuronal regeneration-related protein	3.58e-01	2.09e-02	NA
2. P	Q03886	Putative uncharacterized protein YIR020W-A	5.22e-01	7.03e-08	NA

Showing 1 to 10 of 17 entries